FMG Suite is an automated content marketing system for financial advisors.
Get all 1,535 companies using FMG Suite
CSV with domain, country, industry, employees, funding, socials. Delivered by email.
Companies
1,535
Top Country
US
Top Industry
Advice
Adoption Insights
FMG Suite is used by 1,535 companies in our database, representing approximately 0.05% of all tracked websites. The most common industry using FMG Suite is Advice, and adoption is strongest in US.
Top Countries Using FMG Suite
Top Industries Using FMG Suite
Companies Using FMG Suite
| Company | Domain | Country | Industry | Employees |
|---|---|---|---|---|
 Summit Wealth Group | summitwealthgroup.com | US | Consulting | 51-100 |
 Coghill Investment Strategies | coghillstrategies.com | US | Advice | 1-10 |
 Columbia Financial | columbiafinancialinc.com | US | Asset Management | — |
 Premier Private Wealth | premierprivatewealth.financial | US | Financial Services | 1-10 |
 Objective Capital Management | ocmwealth.com | US | Consulting | 1-10 |
 Orange Investment Advisors | orangeia.com | US | Advice | 1-10 |
 US Financial Services | usfsc.com | US | Finance | 11-50 |
 Arch Global Advisors | archglobaladvisors.com | US | Advice | 1-10 |
 GFP Private Wealth | gries.com | US | Financial Services | 11-50 |
 Badii Group | badiigroup.com | US | Advice | 1-10 |
Top Alternatives to FMG Suite
Other Marketing automation technologies sorted by adoption
How We Detect FMG Suite
The Web Radar detects FMG Suite by analyzing HTTP headers, JavaScript variables, HTML source code, cookies, and DNS records across 3M+ websites. Our detection engine uses over 10,000+ pattern rules to ensure accurate identification. Browse all technologies →
Frequently Asked Questions
What is FMG Suite?+
FMG Suite is an automated content marketing system for financial advisors.
How many companies use FMG Suite?+
1,535 companies in our database use FMG Suite, representing approximately 0.05% of all tracked websites.
What industries use FMG Suite the most?+
The top industries using FMG Suite are Advice, Financial Services, Consulting.
What countries use FMG Suite the most?+
The top countries using FMG Suite are US, GB, DE.
Is FMG Suite popular?+
FMG Suite is used by 1,535 companies, making it one of the most widely adopted Marketing automation technology based on adoption across our tracked websites.
Need this data at scale?
Get ready-to-use datasets: companies, technologies, and tech adoption signals across 3M+ websites.
Browse DatasetsData last updated: June 2026