FMG Suite companies list
3,751 companies detected using FMG Suite. Instant CSV delivery by email.
Get all 3,751 companies using FMG Suite
CSV with domain, country, industry, employees, funding, socials. Delivered by email.
How we compare
Same data, no subscription, no contract.
| Provider | Price | Format | Refund |
|---|---|---|---|
| BuiltWith | $295/mo (~$3,540/yr) | API + dashboard | None |
| SimilarTech | $290/mo | SaaS dashboard | None |
| ZoomInfo | $1,250+/mo (enterprise) | SaaS contract | Annual contract |
| The Web RadarYou're here | $29 – $999 one-time | CSV + JSON download | 7-day refund |
Subscription prices reflect public list prices on the providers' websites at time of writing. Your mileage may vary.
What's inside
- Company Name
- Domain
- Country
- Industry
- Employees
- Revenue Range
- Last Funding Type
- Last Funding Amount (USD)
- Website
Preview
Sample · top 8Here's a taste of what you'll receive. The full CSV contains all 3,751 companies.
| Company | Domain | Country | Industry | Employees |
|---|---|---|---|---|
| summitwealthgroup.com | US | Consulting | 51-100 | |
| coghillstrategies.com | US | Advice | 1-10 | |
| columbiafinancialinc.com | US | Asset Management | — | |
| premierprivatewealth.financial | US | Financial Services | 1-10 | |
| ocmwealth.com | US | Consulting | 1-10 | |
| orangeia.com | US | Advice | 1-10 | |
| usfsc.com | US | Finance | 11-50 | |
| archglobaladvisors.com | US | Advice | 1-10 | |
| + 3,743 more companies in the full dataset | ||||
Buy FMG Suite companies by country
Only need FMG Suite users in a specific country? Pay for the subset that matches your market: same CSV, smaller list, lower price.
Frequently Asked Questions
What do I get?+
A CSV file with 3,751 companies detected using FMG Suite, including domain, country, industry, employees, funding type/amount, and social profiles.
How is delivery handled?+
After payment, you'll receive an email within seconds with a download link valid for 7 days.
Is the data up-to-date?+
Our detection engine re-crawls sites on a rolling basis. Each purchase reflects the most recent state of our database.
Can I get a refund?+
If the CSV is corrupted or significantly inaccurate, reply to the delivery email within 7 days for a full refund.
Get all 3,751 companies using FMG Suite
CSV with domain, country, industry, employees, funding, socials. Delivered by email.