FMG Suite companies in United States
1,812 companies located in United States detected using FMG Suite. Instant CSV delivery by email.
Get all 1,812 companies using FMG Suite in United States
CSV with domain, country, industry, employees, funding, socials. Delivered by email.
How we compare
Same data, no subscription, no contract.
| Provider | Price | Format | Refund |
|---|---|---|---|
| BuiltWith | $295/mo (~$3,540/yr) | API + dashboard | None |
| SimilarTech | $290/mo | SaaS dashboard | None |
| ZoomInfo | $1,250+/mo (enterprise) | SaaS contract | Annual contract |
| The Web RadarYou're here | $29 – $999 one-time | CSV + JSON download | 7-day refund |
Subscription prices reflect public list prices on the providers' websites at time of writing. Your mileage may vary.
What's inside
- Company Name
- Domain
- Country
- Industry
- Employees
- Revenue Range
- Last Funding Type
- Last Funding Amount (USD)
- Website
Preview
Sample · top 8Here's a taste of what you'll receive. The full CSV contains all 1,812 United States companies using FMG Suite.
| Company | Domain | Industry | Employees |
|---|---|---|---|
| Summit Wealth Group | summitwealthgroup.com | Consulting | 51-100 |
| Coghill Investment Strategies | coghillstrategies.com | Advice | 1-10 |
| Columbia Financial | columbiafinancialinc.com | Asset Management | — |
| Premier Private Wealth | premierprivatewealth.financial | Financial Services | 1-10 |
| Objective Capital Management | ocmwealth.com | Consulting | 1-10 |
| Orange Investment Advisors | orangeia.com | Advice | 1-10 |
| US Financial Services | usfsc.com | Finance | 11-50 |
| Arch Global Advisors | archglobaladvisors.com | Advice | 1-10 |
Top industries using FMG Suite in United States
Frequently Asked Questions
What do I get?+
A CSV file with 1,812 companies located in United States and detected using FMG Suite, including domain, country, industry, employees, funding type/amount, and social profiles.
Why buy only United States?+
If your outbound, ads, or research is scoped to United States, paying only for the United States subset keeps your list focused and your cost down. You can always upgrade to the global list later.
How is delivery handled?+
After payment, you'll receive an email within seconds with a download link valid for 7 days.
Is the data up-to-date?+
Our detection engine re-crawls sites on a rolling basis. Each purchase reflects the most recent state of our database.
Can I get a refund?+
If the CSV is corrupted or significantly inaccurate, reply to the delivery email within 7 days for a full refund.
Get all 1,812 companies using FMG Suite in United States
CSV with domain, country, industry, employees, funding, socials. Delivered by email.